PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016464850.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 253aa    MW: 29188.6 Da    PI: 9.5725
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016464850.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B347.92.3e-151695999
                    HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3  9 dvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                      +k+g l +p  f+ ++ +g    +++  +  ++g++W vkl  +     y +++GW++F++ ++L+ gD++vF+++g++ef   v +f++
  XP_016464850.1 16 PGFKNG-LKIPVGFL-KYlKGH--DHIENAILRRDGKKWLVKL--ND----YRFEAGWSDFAEHHDLQLGDMLVFRHEGNMEF--EVVIFDS 95
                    566666.********.665544..4567788899*********..55....55*************************99999..7777775 PP

2B351.71.6e-16152236489
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     + ++++  ++  l++p++fa++ g+ +++  +++l+de  rsW+v+l    +++++ +t+GW +F  a+gL++gD   F+l+++++
  XP_016464850.1 152 AIIKPYCISKPVLYFPRHFAKSSGLMNRK-CEMILKDEAQRSWSVRLGPLAGRRHFGITSGWAKFRAAKGLQVGDAYKFELIKNEK 236
                     567888889999********999877554.59***************77888889**************************98754 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.2E-22398IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.08E-22398IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.492796IPR003340B3 DNA binding domain
CDDcd100171.38E-18894No hitNo description
SMARTSM010192.2E-151096IPR003340B3 DNA binding domain
PfamPF023627.6E-121895IPR003340B3 DNA binding domain
SuperFamilySSF1019366.28E-19144245IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.109.6E-19144242IPR015300DNA-binding pseudobarrel domain
CDDcd100171.28E-17148244No hitNo description
PROSITE profilePS5086312.464149245IPR003340B3 DNA binding domain
SMARTSM010192.0E-14150245IPR003340B3 DNA binding domain
PfamPF023621.8E-15151236IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MKIPPKKPHF FKPILPGFKN GLKIPVGFLK YLKGHDHIEN AILRRDGKKW LVKLNDYRFE  60
AGWSDFAEHH DLQLGDMLVF RHEGNMEFEV VIFDSSHCDR EYVEYLQQQE EANNVEFKGA  120
TNIRKKPSNM IPLNAQVSTP TSGDDDPPYF VAIIKPYCIS KPVLYFPRHF AKSSGLMNRK  180
CEMILKDEAQ RSWSVRLGPL AGRRHFGITS GWAKFRAAKG LQVGDAYKFE LIKNEKIPIA  240
HFHCRYSGIG EEH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009801949.10.0PREDICTED: B3 domain-containing protein REM14-like
RefseqXP_016464850.10.0PREDICTED: B3 domain-containing protein REM14-like
TrEMBLM1CHN81e-109M1CHN8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000676641e-108(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32215171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.14e-36B3 family protein